PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g032590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 208aa    MW: 23279 Da    PI: 8.9963
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g032590.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-1967122156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rrk+ ++tkeq + Lee F +n++++ +++++LA+ l+L++rqV vWFqNrRa+ k
  Csa16g032590.1  67 RRKKLRLTKEQSHHLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSK 122
                     79999*************************************************98 PP

2HD-ZIP_I/II109.32.7e-3568156190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rl+keq++ LEesF ++++L+p++K++la+ L+l++rqv+vWFqnrRAR k+k++E+++e+Lkr++ +lke+n+rL+ eveeLr +
  Csa16g032590.1  68 RKKLRLTKEQSHHLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEMECEYLKRWFGSLKEQNRRLQIEVEELR-A 156
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-1953122IPR009057Homeodomain-like
SuperFamilySSF466891.8E-1955123IPR009057Homeodomain-like
PROSITE profilePS5007117.84864124IPR001356Homeobox domain
SMARTSM003897.0E-1766128IPR001356Homeobox domain
PfamPF000461.7E-1667122IPR001356Homeobox domain
CDDcd000867.69E-1667125No hitNo description
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
SMARTSM003401.7E-16124167IPR003106Leucine zipper, homeobox-associated
PfamPF021833.0E-9124158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MAISPNSSSL ELTISIPSFS PSPSSPGGDH HGMRDFDINQ TPKTEADHTI GATQHANEED  60
SNSGGRRRKK LRLTKEQSHH LEESFIQNHT LTPKQKKDLA TFLKLSQRQV EVWFQNRRAR  120
SKLKHTEMEC EYLKRWFGSL KEQNRRLQIE VEELRALKPS STTALTMCPR CERVSDAADN  180
DSNAVQEGAA VSSSRSRITI SSSSSLC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16472GRRRKKLRL
26571RRRKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1758370.0AK175837.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-44-P21.
GenBankAK1759650.0AK175965.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-65-O17.
GenBankEU3391860.0EU339186.1 Arabidopsis thaliana HD-ZIP transcription factor 18 (ATHB18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010471099.11e-153PREDICTED: homeobox-leucine zipper protein ATHB-X-like
SwissprotQ8GXM71e-116ATHBX_ARATH; Homeobox-leucine zipper protein ATHB-X
TrEMBLA9Z1E81e-114A9Z1E8_ARATH; HD-ZIP transcription factor 18
STRINGAT1G70920.11e-113(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133801624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70920.11e-107homeobox-leucine zipper protein 18